Badai Ophelia pada Kursus Rare Menuju Ireland, U.K.


                     Badai Ophelia pada Kursus Rare Menuju Ireland, U.K.

            
                                            

Radiometer Imaging Pengimejan Inframerah Terhadap satelit PLN Suomi menangkap imej Ophelia yang menghampiri Azores pada 13 Oktober 2017.

                     Kredit: NASA Earth Observatory
                

            

Seolah-olah musim badai 2017 belum cukup terkenal, kini Hurricane Ophelia berada di landasan yang jarang berlaku ke arah Ireland dan Kepulauan British. Walaupun ia tidak akan lagi menjadi sistem tropika apabila ia sampai kepada mereka, ia masih boleh membawa hujan, laut yang ribut dan angin menghembus sehingga 80 mph (129 km / h).

Ophelia adalah badai ke-10 musim yang sangat sibuk, dengan ribut yang memecahkan banyak rekod, dari 40 hingga 60 inci (100 hingga 150 sentimeter) hujan Hurricane Harvey tanpa henti dibuang ke kawasan Houston untuk Hurricane Maria – ribut Kategori 5 pertama untuk memukul pulau Dominika di Caribbean.

Musim 2017 mengandungi lebih banyak hari dengan taufan Kategori 5 berbanding mana-mana tahun yang dirakam, Michael Lowry, Universiti Corporation untuk Penyelidikan Atmosfera, tweeted. Dengan Ophelia, musim ini hanya menjadi keempat dalam rekod untuk melihat 10 bentuk taufan berturut-turut, menurut Phil Klotzbach, penyelidik taufan di Colorado State University.

Walaupun Ophelia bukan badai blockbuster seperti Irma atau Maria, ia mempunyai tuntutan sendiri untuk kemasyhuran. Dengan angin 100 mph, ia merupakan ribut kuat yang terbentuk setakat timur di Lautan Atlantik dalam rekod, Klotzbach tweeted. A Kategori 2 taufan belum maju jauh di utara dan timur sejak tahun 1992, Eric Blake, seorang peramal dengan Pusat Hurricane Negara, tweeted.

Ophelia telah dapat berkembang bukan sahaja kerana air lautan yang lebih hangat, tetapi juga kerana suhu udara yang lebih sejuk dan dingin.

"Gabungan itu membenarkan ribut untuk menguatkan lebih banyak daripada yang dijangkakan" kerana atmosfernya tidak stabil, Klotzbach memberitahu Live Science dalam e-mel.

Kursus Ophelia mengikuti juga agak luar biasa, walaupun tidak pernah berlaku sebelum ini

Badai Debbie melanda Ireland pada tahun 1961, walaupun tidak jelas sama ada ia masih merupakan sistem tropika atau telah beralih ke apa yang disebut sebagai siklon extratropical. Siklon tropika mempunyai teras hangat dan peredaran simetri, manakala sistem extratropical didorong oleh perbezaan suhu di hadapan cuaca dan mempunyai bentuk koma.

Sistem-sistem yang mencapai Ireland dan U.K. cenderung menjadi orang-orang yang telah mengalami peralihan tropika-ke-extratropical.

"Kami telah melihat kesan langsung dari sisa-sisa teras kesan siklon tropika Ireland dan U.K. sebelum ini; terutamanya Ex-Charley (1986) dan Ex-Katia (2011), "Steven Bowen, pengarah ramalan impak di syarikat insurans semula, Aon Benfield, dalam e-mel. "Senario jenis ini jarang berlaku tetapi tidak sepenuhnya belum pernah berlaku sebelumnya."

Satu kajian pada tahun 2013 dalam jurnal Penyelidikan Geophysical Letters menunjukkan bahawa Eropah Barat dapat melihat lebih banyak ribut dengan angin badai yang memaksa angin sebagai perairan panas di Atlantik timur, didorong oleh peningkatan suhu global, mengembangkan kawasan utama pembangunan taufan dan memudahkan lagi ribut mengekalkan kekuatan dan ciri-ciri tropika ketika mereka tiba di Eropah.

Eropah melihat ribut angin angin taufan yang sememangnya extratropical asalnya, kebanyakannya telah menyebabkan kerosakan dan kerugian kewangan yang besar, kata Bowen.

Ophelia dijangka beralih ke sistem extratropical apabila ia bergerak ke arah Ireland dan perairan laut yang lebih sejuk dan berinteraksi dengan sistem tekanan rendah yang lain.

Kerana laluan sebenar Ophelia masih tidak menentu, begitu juga kesannya. Bagi Ireland, "angin ribut berkuatkuasa, hujan lebat dan laut yang tinggi terancam," menurut Met Éireann, Perkhidmatan Meteorologi Ireland.

The UK Met Office, perkhidmatan meteorologi kebangsaan, memberi amaran angin ribut angin sekitar 50 hingga 60 mph (80 hingga 97 km / j), dengan beberapa hantu yang mungkin lebih tinggi di kawasan tertentu di Ireland Utara dan pantai barat Scotland, Wales dan England pada Isnin. Angin kemudiannya akan tertumpu di Ireland Utara, Scotland selatan dan utara England pada hari Selasa.

Angin-angin itu akan menyeberang laut dan boleh menyebabkan gangguan elektrik dan gangguan perjalanan, kata Pejabat Met.

Artikel asal mengenai Sains Live.

        

Jangan Siang Bulan Sembunyi Bintang Regulus Bright Sebelum Ahad Ahad!


            

Ahad pagi (15 Oktober) sepatutnya mendapat bulatan besar di kalendar celestial anda jika anda tinggal hampir di mana saja di Amerika Syarikat bersebelahan atau tenggara Kanada. Semasa waktu yang akan datang, bulan sabit yang menelan akan menyembunyikan sementara Regulus bintang dalam apa yang dikenali sebagai "ghaib." Ini pandangan yang baik dari acara ini untuk Amerika Utara sehingga tahun 2026!

Regulus bintang yang berkekuatan 1.4 magnitud dikenali sebagai jantung Singa di Leo. Nama bintang Latin ialah "raja kecil". Ia juga merupakan satu-satunya bintang magnitud yang pertama yang duduk hampir tepat pada laluan tahunan ekliptik atau matahari di hadapan buruj zodiak; ia terletak hanya 0.46 darjah dari garis ekliptik.

Akibatnya, Regulus boleh disembunyikan oleh bulan dalam ghaib, dan pada pagi hari Ahad semata-mata penglihatan akan disediakan untuk orang yang tinggal di kebanyakan AS bersebelahan (kecuali Barat Laut Pasifik dan sebahagian dari Dataran Utara) , serta lebih dari sekeping tenggara Kanada dan sebahagian daripada Wilayah Maritim. Berhampiran dan sepanjang Pantai Barat, Regulus akan tersembunyi di sebalik bulan apabila ia naik tidak lama selepas 2:30 pagi PDT. [The Brightest Stars in the Night Sky]

                    
            

Batasan utara zon keterlihatan ghaib bermula di pusat Oregon dan kemudian menjejaki ke timur laut melalui pertengahan Idaho. Kemudian ia melintasi bahagian-bahagian selatan Montana dan North Dakota dan terus timur-timur laut melalui utara Minnesota, memotong terus melalui rantau Arrowhead sebelum menuju ke Lake Superior.

Mereka yang berada di atas atau di utara garis penglihatan akan kehilangan, harus menyelesaikan pendekatan dekat bulan ke bintang. Walau bagaimanapun, jika kawasan anda dijangka terlepas, keluar dan tonton pula. Sangat menarik untuk melihat bintang yang terang "terbang" begitu dekat dengan bulan!

Peta Google yang menggambarkan laluan rumput, dengan ihsan IOTA – Persatuan Masa Occultasi Antarabangsa – boleh didapati di sini.

Selepas pemeriksaan dekat peta Google itu, anda akan melihat bahawa laluan ghaib merangkumi tiga garis mendatar. Garis hijau adalah had yang diramalkan jika bulan adalah sfera yang sempurna. Garis atas dan bawah merangkumi zon di mana bintang itu mungkin akan hilang dan muncul semula lebih daripada sekali apabila ia berlalu di belakang bukit dan lembah bulan – ghaib yang meragukan hebat! Lokasi laluan tidak pasti dengan mungkin kurang dari satu batu.

Oleh kerana Regulus sangat dekat dengan pemerhatian ekliptik, terperinci tentang kegilaannya mempunyai nilai khusus untuk meningkatkan pengetahuan tentang bahagian profil lunar yang diperlukan untuk analisis pemerhatian gerhana matahari. Pusat laluan padang rumput melewati sangat dekat dengan Billings, Montana, dan Bismarck, North Dakota. Ramalan ramuan adalah oleh Brad Timerson.

                    
            

Occultations of Regulus berlaku dalam kitaran kira-kira sembilan tahun, dan setiap kitaran berlangsung sekitar 18 bulan. Kitaran semasa bermula tahun lepas pada 18 Disember dan akan berakhir pada 24 April 2018. Jadi setiap bulan, bulan akan menyeberangi laluan dengan Regulus, menyembunyikannya dari pandangan untuk pelbagai bahagian dunia.

Dan pada hari Ahad, ia akan menjadi giliran kami. Dan ini pandangan terakhir yang baik untuk Amerika Utara sehingga tahun 2026.

Di sesetengah tempat, acara ini akan menjadi sangat indah. Tetapi kualiti pandangan bergantung kritis di mana anda berada. Penonton yang paling beruntung adalah orang-orang di zon dari negara-negara selatan-selatan ke Great Lakes. Sekiranya anda berada di sana, anda akan melihat perlindungan bulan yang diterangi Bumi dan mendedahkan Regulus di langit yang gelap di atas ufuk.

Apabila bulan bergerak ke timur melawan bintang-bintang latar belakang, sebelah terang bulan sabit yang perlahan akan mula lulus di hadapan Regulus, silau bulan akan menghalangnya daripada menjadi peristiwa mata kasar. Tetapi dalam teleskop, ia perlu menjadi hebat.

Apabila pendekatan okultasi, ia akan menarik untuk membandingkan kecerahan permukaan bintang hingga ke bulan. Biasanya, landskap lunar kelihatan sangat brilian, tetapi berbanding dengan bintang, ia menjadi kuning yang membosankan. Semakin baik melihat, bintang yang lebih kecil akan muncul dan kesannya akan lebih sengit.

Regulus kelihatan seperti berlian biru berlumuran di atas padang pasir bulan yang terang. Sama ada ia dapat dilihat sama sekali, ini pasti menunjukkan bernilai menetapkan jam penggera anda.

Bintang itu akan muncul semula sehingga 70 minit kemudian, bergantung kepada lokasi anda, di sebalik bahagian "bulan" yang gelap, yang mungkin akan diterangi oleh cahaya bumi. Dari semua perkara yang berlaku di sfera langit, ghaib adalah salah satu yang paling dramatik dan mungkin yang paling mendadak.

Sekiranya kemunculan semula Regulus dijangka berlaku sekurang-kurangnya beberapa darjah di atas cakrawala timur pada awal senja atau kegelapan di tapak anda, anda tidak memerlukan peralatan sama sekali. Hanya teruskan memandang dengan mantap, jadi anda tidak akan terlepas segera bintang itu secara dramatik "muncul" kembali ke dalam pandangan.

Bagi mereka yang terletak di timur A.S. dan tenggara Kanada, kemunculan Regulus akan berlaku pada waktu senja pagi. Semakin dekat anda ke pesisir Atlantik, lebih dekat kedatangan semula akan datang ke matahari terbit – karenanya, langit yang cerah.

Kehilangan dan kemunculan semula akan dilihat paling baik dalam teropong atau teleskop kecil. Mereka mungkin penting jika bulan dan bintang sangat dekat dengan ufuk dan redup oleh lapisan rendah jerebu. Binokular perlu di tripod atau beberapa gunung lain yang stabil.

Berikut adalah senarai 15 bandar terpilih yang menyediakan masa tempatan apabila Regulus akan mengedip di belakang bulan sabit bulan cerah dan muncul semula dari belakang lunar bulan yang gelap.

PERKHIDMATAN TEMPATAN UNTUK PERUBAHAN,
OF REGULUS,
MINGGUAN, OKTOBER 15, 2017
Lokasi Hilang Reappears
San Francisco Sebelum penembusan bulan 3:11 a.m.
Los Angeles, California Sebelum penembusan bulan 3:12 a.m.
Tucson, Ariz. Sebelum penembusan bulan 3:14 a.m.
Denver, Colo. 3:31 a.m. 4:15 a.m.
Austin, Texas 4:18 a.m. 5:19 a.m.
New Orleans, La. 4:20 a.m. 5:25 a.m.
Kansas, City, Mo. 4:29 a.m. 5:22 a.m.
Chicago, Ill. 4:37 a.m. 5:27 a.m.
Atlanta, Ga. 5:25 a.m. 6:33 a.m.
Miami, Fla. 5:25 a.m. 6:33 a.m. *
Washington, D.C. 5:37 a.m. 6:41 a.m. *
New York 5:44 a.m. 6:43 a.m. *
Toronto, Ontario 5:47 a.m. 6:32 a.m. *
Boston 5:50 a.m. 6:44 a.m. *
Montreal, Quebec 5:57 a.m. 6:37 a.m. *

* Menunjukkan senja pagi telah bermula.

Anda juga boleh melawat laman web ini untuk mengetahui masa ghaib untuk beratus-ratus lokasi di Universal Time (UT). Ingat untuk menukar Waktu Universal ke masa tempatan anda: Waktu Waktu Siang Timur = UT minus 4 jam; Waktu Siang Tengah = UT tolak 5 jam; Waktu Siang Gunung = UT tolak 6 jam; Waktu Siang Pasifik = UT tolak 7 jam.

Walaupun jam awal, anda mungkin ingin mempertimbangkan mengundang ahli keluarga anda atau jiran anda untuk menyertai anda dalam menyaksikan demonstrasi menarik jentera sistem suria ini. Siapa tahu? Ghaib ini mungkin memberi kesan yang hebat kepada mereka – sememangnya cuaca dan keadaan memerhati membenarkannya.

Anda boleh menerangkan kepada mereka bahawa Regulus adalah bintang biru 4.5 kali lebih besar daripada (dan 160 kali lebih cerah daripada) matahari, dan bahawa bintang cahaya yang mereka lihat kini sebenarnya bermula pada perjalanan ke Bumi kira-kira 85 tahun yang lalu.

Sebagai perbandingan, bulan hanya 1.25 cahaya-saat jauh.

Sekiranya anda meluangkan peluang hari Ahad dan merancang untuk menunggu ghaib Regulus yang seterusnya yang memberi sokongan kepada Amerika Syarikat dan Kanada, anda akan menunggu lama: Ini akan berlaku pada jam 2 malam pada 2 Februari 2026 , dan ia akan melibatkan bulan yang berkilauan dan terang.

Notis editor: Jika anda mempunyai foto langit malam yang menakjubkan, anda ingin berkongsi dengan kami dan rakan berita kami untuk cerita atau galeri imej yang mungkin, menghantar imej dan komen ke spacephotos@space.com.

Joe Rao berfungsi sebagai pensyarah dan pensyarah tamu di Planetarium Hayden New York. Dia menulis tentang astronomi untuk majalah Natural History, Almanac Petani dan penerbitan lain, dan dia juga ahli meteorologi kamera Fios1 di Rye Brook, NY. Ikut kami @Spacedotcom, Facebook atau Google+. Asalnya diterbitkan di Space.com.

        

Bagaimana Kebakaran Napa Boleh Menipu Anggur Anggur 2017


Nick Goldschmidt telah telah bertuah setakat ini. A api liar telah membakar lebih daripada 8,000 ekar di utara ladang anggurnya di Geyserville, California, tetapi setakat ini anggurnya OK. Begitu juga rumahnya di Healdsburg, kira-kira pertengahan antara Geyserville dan kebakaran seluas 36,000 hektar yang menghancurkan lebih daripada 2,800 rumah di Santa Rosa.

Tetapi sekarang, di tengah-tengah ruang kosong yang kosong, rantau, di bawah langit yang diliputi asap, Goldschmidt mempunyai perlumbaan untuk menang. Kebakaran hutan boleh merosakkan rasa wain anggur, masalah yang dikenali sebagai asap rokok. "Saya pernah bekerja dengan asap sebelum ini," kata Goldschmidt. "Ia bukan perkara mudah untuk diperbaiki. Tetapi dalam pengalaman saya, ini lebih lanjut mengenai masa kenalan. Jadi, perkara utama adalah, jika anda mempunyai kebun-kebun anggur berhampiran api, anda mesti mendapatkan anggur. "

Bergantung pada angin, asap dari Atlas Fire berpotensi untuk mencapai kebun anggur Napa Goldschmidt, di mana kira-kira 15 peratus buah masih dituai. Beliau kini merancang untuk menuai selebihnya pada hujung minggu.

Itu tipikal Napa, di mana 80 hingga 85 peratus daripada panen 2017 dilakukan. Di Sonoma yang berdekatan, 90 peratus buah anggur ada di dalamnya. Tetapi itu masih bererti bahawa beberapa buah anggur boleh terdedah kepada asap, dan kebakaran dan haba dapat merosakkan anggur. Di rantau ini untuk industri wain California $ 34 bilion-dan angka itu tidak termasuk perniagaan pelancong yang besar-itu adalah masalah besar. Kebakaran telah membunuh 31 orang setakat ini, memusnahkan ribuan rumah, dan menggunakan usaha lebih dari 8,000 anggota bomba. Dan pembuat wain di kawasan itu cuba memastikan kerosakan kepada mata pencarian mereka tidak menjadi lebih buruk.

Kawasan pemenang di seluruh dunia, terutama di Australia, telah berhadapan dengan akibat musim api yang lebih aktif berhampiran kebun-kebun anggur sejak sekurang-kurangnya pergantian abad ini-tetapi masalahnya masih belum mencecah California. Kebakaran yang sering berlaku di negeri ini tidak berpotongan dengan kebun-kebun anggurnya. Sehingga kini.

Asap adalah barangan rumit. Semua orang di Bay Area telah mendapat rasa dalam beberapa hari kebelakangan – bahawa ubat-ubatan, ashy, rasa terbakar berasal dari antara bahan-bahan lain, molekul yang dikenali sebagai hidrokarbon aromatik polisiklik, oksida nitrogen dan sulfur, sebatian organik lain, dan juga zarah-zarah kecil oleh haba dan arus udara. Sekiranya anda pernah duduk berdekatan dengan api unggun atau dimasak di atas panggangan, anda tahu bahawa ia tidak semestinya suatu aroma yang tidak menyenangkan, seperti kognitiviti yang menyuarakan perasaan seperti yang anda rasakan apabila anda menyedari ia berasal dari blazes yang telah memusnahkan ribuan nyawa.

Tetapi apa yang lazat dalam bacon atau lox umumnya tidak bergantung kepada berapa banyak yang anda ada-dalam wain. Sebatian rasa sebenar adalah molekul yang dinamakan fenol yang tidak menentu. "Volatile" bermakna mereka menguap, dan dalam kimia "fenol" adalah cincin benzena (satu segi enam atom karbon dengan atom hidrogen yang melekat seperti salji salju) yang berkaitan dengan hidrogen dan oksigen. Anda mungkin tahu mereka lebih baik sebagai aroma gambut di sesetengah wiski atau antiseptik atau Band-Aids. Ketidakturunan mereka bermakna bahawa di dalam mulut anda, mereka menjadi wap yang disedut secara retronas, melalui bahagian belakang kerongkong ke lapisan sensitif saraf di belakang hidung anda yang menterjemahkan bahan kimia ke dalam bau.

Asap tercemar dalam anggur mempunyai dua penanda tertentu: guaiacol dan 4-methylguaiacol. Mereka rasa seperti, baik, asap. Paparkan anggur pada anggur kepada mereka, dan wain akan rasa berasap. Jelas, betul? Kecuali tidak. "Mekanisme ini agak tidak jelas," kata Kerry Wilkinson ahli oenologi yang mengkaji asap rokok di Universiti Adelaide. Daun mempunyai pori-pori yang dipanggil stomata yang terlibat dalam pernafasan, "tetapi apabila pokok anggur terdedah kepada asap, stomata hampir hampir serta-merta dan fotosintesis berhenti," katanya. "Konjugasi guaiacol semakin tidak hanya kulit tetapi pulpa buah. Saya fikir ia hanya permeasi, tetapi saya tidak fikir sesiapa melakukan penyelidikan. "

Membuat perkara-perkara yang lebih rumit, buah anggur mempunyai cara sendiri untuk berurusan dengan barbeku. "Sebatian itu, apabila mereka diambil, ubat anggur akan melekatkan satu atau lebih molekul gula pada mereka," kata Wilkinson. "Kami fikir itu untuk menjadikannya kurang toksik kepada tumbuhan." Proses ini – ia dipanggil glycosylation, dan gula dipanggil glycosides-menjadikan fenol tidak berubah-ubah tidak berubah-ubah. Ini bermakna anda tidak dapat merasainya dalam jus anggur.

Tetapi menapai jus itu menjadi wain, dan asid di dalamnya akan memecahkan gula-gula itu. Poof: Asap mendapat wain anda.

Saya tidak bermaksud untuk menjadi flip sini; asap rokok dari ladang tumbuhan Canberra tahun 2003 menelan kos kebun anggur Australia lebih daripada $ 4 juta; kebakaran pada tahun 2004 menelan belanja $ 7 juta lagi. Sekali anggur dicemari, wain tidak mudah untuk diperbaiki. Mereka rasa terlalu kuat; anda tidak boleh cuba menggabungkannya dengan wain lain yang tidak tercemar untuk menutupnya. Upaya penyaringan dengan arang diaktifkan dan osmosis terbalik dapat menyaring rasa yang mungkin Anda inginkan dalam wain juga. Heck, guaiacol dan 4-methylguaiacol adalah penanda untuk penuaan oak-barel juga. Tiada siapa yang pernah menggambarkan Chardonnay yang terlalu oak sebagai "dicemari asap," tapi-baik, mungkin mereka sepatutnya. Dan beberapa varietals-shiraz anggur, khususnya-sudah mempunyai tahap guaiacol yang tinggi secara semulajadi.

Semua yang mungkin baik-baik saja. Kebanyakan anggur telah dipilih sebelum kebakaran datang. Secara umum, "jika buah telah dituai tahun ini, ia harus baik," kata Wilkinson. Beberapa seteri selusin menderita kerosakan setakat ini, dari kecil kepada jumlahnya. Tetapi California Utara mempunyai hampir 250,000 ekar wain anggur anggur-lebih daripada 100,000 daripada mereka di Napa dan Wilayah Sonoma pada 2016.

Ia kelihatan seperti anggur hasil tanaman anggur akan OK tahun depan. "Tiada kesan sampingan dari satu musim ke yang lain," kata Wilkinson. "Kami tidak melihat apa-apa bukti untuk menunjukkan bahawa mana-mana sebatian asap yang terikat dari satu musim ke musim yang lain di dalam anggur." Mereka masuk ke dalam anggur, yang keluar, dan daun, yang jatuh atau dipangkas. (Dan sedikit lebih beruntung: Anggur yang ditinggalkan untuk menuai di Napa adalah kebanyakannya Cabernet Sauvignon yang ternyata lebih tahan untuk menghisap rokok daripada beberapa varietal lain.)

Tetapi anggur sendiri sensitif terhadap panas. "Mereka boleh dibakar, dan jika ia teruk, ia boleh merosakkan atau membunuh anggur secara kekal," kata Wilkinson. "Sekiranya hanya sedikit terik, anggur boleh sembuh, tetapi hasilnya dapat menurun dalam musim sejurus selepas itu."

Ternyata sukar untuk membakar kebun anggur California. Sebahagiannya adalah kerana kebanyakannya ditanam, jadi mereka basah dan dengan demikian tahan api. Walaupun tanaman penutup yang tumbuh di antara pokok anggur itu dibakar dengan api yang sangat cepat, "agak susah payah" untuk mendapatkan kebun anggur California untuk ditangkap, kata Goldschmidt.

Walaupun dia bekerja di Chile, dia melihat api yang didorong oleh angin sangat mirip dengan orang-orang yang mempengaruhi California memusnahkan kebun anggur. "Itu dahsyat," kata Goldschmidt. "Kebanyakan ladang-ladang anggur ini kering-ladang, jadi mereka membakar lebih mudah."

Kerosakan haba adalah seperti kerosakan fros, sesuatu yang tahu tentang California. Pemangkasan dan rawatan yang betul boleh menyelamatkan anggur yang cedera. Caranya adalah mengetahui jika mereka cedera, dan betapa teruknya. Kadang-kadang para vintners perlu memotong batang anggur untuk menilai sama ada kelopak, bahagian hidup dan berkhasiat kayu, masih sihat. Tetapi itu ujian yang merosakkan-kadang-kadang memusnahkan pokok itu dalam cubaan untuk menyelamatkannya.

Jadi penanam anggur mencari cara lain untuk menilai anggur mereka. "Kami melihat perkara-perkara seperti, garis irigasi cair? Adakah terdapat tanda-tanda terik pada batang dan kanopi? Berapa banyak kerosakan kebakaran di sana untuk apa-apa yang tumbuh di antara anggur? "Kata Wilkinson.

Itu penilaian yang mungkin perlu menunggu sehingga kebakaran berada di bawah kawalan. Mungkin nasib Goldschmidt akan bertahan. "Ini adalah varian ke-29 saya di Sonoma. Ini kali pertama Lembah Alexander lebih awal daripada kemunculan Lembah Napa. Biasanya ia 10 hari kemudian, "katanya. "Jika ia adalah cara lain, saya pasti telah dibelasah."

Biasanya saya mungkin mengakhiri cerita itu, tetapi dalam kes ini ia tidak bernasib baik. Napa dan Sonoma sememangnya mempunyai tahun yang pelik. Ia hujan lebat selepas bertahun-tahun kemarau, dan kemudian pada musim panas ia menjadi sangat panas. Vintners irigasi apabila mereka tidak mempunyai, yang menurunkan paras gula dalam anggur ketika mereka mengambil air … dan kemudian ia menjadi panas sekali lagi. "Sukar untuk membuat keputusan menuai berasaskan gula," kata Goldschmidt. "Ia lebih banyak tentang rasa dan tanin."

Berdasarkan penilaian organoleptik itu-cara yang paling mungkin untuk mengatakan "bagaimana rasanya" -banyak Napa dan Sonoma membawa buahnya pada bulan Julai dan Ogos, Baiklah, sekarang.

Kepada siapakah yang akan mengucapkan terima kasih? "Dalam tempoh lima tahun yang lalu atau lebih, kami telah mempunyai suhu yang sangat tinggi ini yang bertepatan dengan hujan yang rendah, diselaraskan oleh keadaan yang sangat basah," kata Noah Diffenbaugh seorang penyelidik iklim di Stanford. Ini adalah kumpulan Diffenbaugh yang diingatkan akan berlaku pada kertas pramatang 2006 di [1945906] Prosiding Akademi Sains Kebangsaan bertajuk "Haba yang melampau mengurangkan dan mengalihkan premium Amerika Syarikat pengeluaran wain pada abad ke-21. "

Titik mereka? Mula-mula, hujan panas dan jarang berlaku tetapi akan mengubah bagaimana kawasan winegrowing berfungsi. Hampir lebih banyak kawasan utara akan menjadi lebih baik untuk anggur-hello, Lembah Willamette Oregon-dan kawasan-kawasan anggur yang sedia ada akan mengubah jenis-jenis yang mereka tumbuh.

Ini adalah pemanasan global yang melampau . "Kami telah melakukan banyak kerja yang cuba memahami bagaimana pemanasan global memberi kesan kepada suhu yang melampau," kata Diffenbaugh. "Ekstrem adalah benar-benar di mana kita merasakan iklim."

Perubahan iklim yang membimbangkan membolehkan vintage 2017 kebanyakannya menghindari kemusnahan ekonomi yang asap rokok akan menyebabkan. Ini lapisan perak yang lemah untuk awan abu dan asap yang kini diletakkan di atas ribuan hektar kematian dan kemusnahan. Tetapi lapisan perak itu tidak akan bertahan lama. Ini tidak akan menjadi kebakaran terakhir; Masa depan, mungkin penuaian tidak akan berlaku terlebih dahulu. Kebenaran yang paling menakutkan tentang peristiwa iklim ekstrem yang kebakaran di utara California ialah peristiwa-peristiwa seperti itu tidak akan selalu melampau. Mereka akan menjadi normal.

Adakah Pulau Paskah mempunyai Hubungan Awal dengan Amerika Selatan?


                     Adakah Islander Paskah Mempunyai Hubungan Awal dengan Amerika Selatan?

            
                                            

Pulau Paskah terkenal dengan patung-patung Moai ikonik ini, serta misteri yang mengelilingi penduduk pulau itu.

                     Kredit: Terry Hunt
                

            

Pada peta, Pulau Easter adalah jarak jauh lebih dari 2,000 batu (3,219 kilometer) dari pantai barat Chile. Ia telah lama tertarik dengan ahli arkeologi-bukan hanya untuk beratus-ratus patung besarnya, yang dipanggil moai, tetapi juga kerana ia dapat memegang petunjuk tentang pelayaran laut Pasifik epik dan mash-up kebudayaan berikutnya yang berlaku sebelum kedatangan orang Eropah.

Kebanyakan cendekiawan berpendapat bahawa Pulau Paskah, yang juga dikenali dengan nama asli Rapa Nui, yang pertama dihuni oleh Polynesia yang tiba sekitar AD 1200. Tetapi ada juga beberapa bukti bahawa peneroka awal pulau itu berinteraksi dengan orang asli Amerika Selatan sebelum orang Eropah muncul pada tahun 1722 .

Satu kajian baru yang diterbitkan semalam (12 Oktober) dalam jurnal Biologi Semasa, menambah perdebatan. Para saintis memandang lima kerangka dari budaya Rapanui dan tidak menemukan jejak genetik keturunan asli Amerika, bertentangan dengan pernyataan awal hubungan dengan orang-orang Amerika Selatan. [Image Gallery: The Walking Statues of Easter Island]

"Kami benar-benar terkejut tidak ada apa-apa," kata pemimpin kajian Lars Fehren-Schmitz, profesor antropologi bersekutu di UC Santa Cruz, dalam satu kenyataan. "Terdapat banyak bukti yang seolah-olah masuk akal, jadi kami yakin bahawa kami akan mendapat bukti langsung mengenai hubungan pra-Eropah dengan Amerika Selatan, tetapi tidak ada di sana."

Fehren-Schmitzand rakan-rakannya mengambil sampel dari rusuk-rusuk kerangka yang ditemui pada tahun 1980-an sewaktu arkeologi digat di laman pantai Ahai Nau Nau. Sesetengah tulang bermula sejak awal 1445, manakala yang lain dikebumikan menjelang 1925, selepas hubungan Eropah. Dalam semua kes, tiada kesan DNA bagi penduduk asli Amerika Syarikat.

Idea bahawa penduduk Amerika Selatan yang pertama memasuki Pulau Paskah dicadangkan pada tahun 1950 oleh Thor Heyerdahl, ahli antropologi Norway yang terkenal dengan ekspedisi rakit Kon-Tiki. Dia melihat ubi keledek yang berasal dari Andes yang tumbuh di Rapa Nui, dan menyaksikan persamaan antara alat penangkapan ikan, sifat bahasa dan patung batu pra-Inca di pulau dan tanah besar.

Hari ini, konsensus arkeologi adalah bahawa orang Polinesia-yang mahir dalam pelayaran lautan jauh dan menetap pulau-pulau Pasifik yang tersebar-mendapat ke Rapa Nui terlebih dahulu. Tetapi para sarjana tidak membuang idea Ide Heyerdahl tentang hubungan awal dengan Amerika Selatan.

Erik Thorsby dari University of Oslo, yang tidak terlibat dalam kajian baru, sebelum ini menemui beberapa penanda genetik yang tipikal dari orang asli Amerika di rangka Rapanui.

Berdasarkan pemeriksaan baru-baru ini, Thorsby mencadangkan bahawa penduduk asli Amerika mungkin datang Rapa Nuias pada awal 1280 hingga 1495 AD, mungkin dengan menumpang dengan orang Polinesia yang kembali dari kunjungan ke pantai Amerika Selatan.

Thorsby berkata beliau berpendapat penemuan baru itu menarik, tetapi menambah bahawa "amaran yang sangat baik perlu dilaksanakan dalam membuat kesimpulan umum sejak DNA purba dari hanya lima individu yang berbeza dipelajari." Beliau menyatakan bahawa kajian lepas telah mendedahkan peratusan kecil keturunan asli Amerika Asli di hanya beberapa individu dari pulau itu. Oleh itu, mungkin hanya beberapa orang Amerika Asli yang mencapai Rapa Nui lebih awal dan gen nenek moyang mereka "mungkin mudah terlepas apabila DNA purba dari hanya lima individu disiasat," katanya kepada Live Science melalui e-mel.

Artikel asal mengenai Sains Live.

        

Cradle for Life? Marikh Kuno Mungkin Telah Terbenam Hidroterma Deep-Sea


                     Cradle for Life? Mars Muncul Mungkin Terhadap Vakum Hidrotermal Deep-Sea

            
                                            

Pandangan ini sebahagian dari rantau Eridania Mars menunjukkan blok-blok kedalaman lembangan yang telah dikelilingi dan sebahagiannya dikebumikan oleh deposit gunung berapi yang lebih muda

                     Kredit: NASA / JPL-Caltech / MSSS
                

            

Mars Kuno mungkin telah membendung lubang hidroterma laut dalam, jenis persekitaran yang sama di mana ramai ahli sains berfikir kehidupan di Bumi mendapat permulaannya, satu kajian baru-baru ini mencadangkan.

Pemerhatian oleh Mars Reconnaissance Orbiter (MRO) menunjukkan bukti deposit hidroterma di dasar laut di dalam lembangan Eridania – rantau di hemisfera selatan di mana beberapa kerak paling tua di Planet Merah terdedah.

Deposit dipercayai terbentuk disebabkan oleh aktiviti gunung berapi di kerak bumi di dasar lembangan. Oleh itu, ahli pasukan kajian berpendapat bahawa air yang penuh dengan mineral yang dipam terus terus ke laut Martian kuno, yang mungkin mempunyai 10 kali lebih banyak air daripada semua gabungan Great Lakes Amerika Utara, kata para pegawai NASA. [The Search for Life on Mars (A Photo Timeline)]

"Walaupun kita tidak pernah mendapati bukti bahawa hidup di Marikh, laman web ini boleh memberitahu kita tentang jenis persekitaran di mana kehidupan mungkin bermula di Bumi," kata pengarang bersama Paul Niles, ahli sains planet di NASA Johnson Space Center di Houston, dalam satu kenyataan. "Aktiviti gunung berapi digabungkan dengan air berdiri menyediakan keadaan yang mungkin serupa dengan keadaan yang wujud di Bumi pada masa yang sama – ketika kehidupan awal berkembang di sini."

 Basin Eridania selatan Mars dipercayai telah memancing kira-kira 3,7 miliar tahun yang lalu, dengan deposit laut yang mungkin disebabkan oleh aktivitas hidrotermal bawah air.

Basin Eridania selatan Mars dipercayai telah menangkap laut kira-kira 3,7 miliar tahun yang lalu, dengan deposit laut yang mungkin disebabkan oleh aktivitas hidrotermal bawah air.

             Kredit: NASA

Penyelidik menganggarkan bahawa deposit hidroterma yang terdapat dalam lembangan Eridania adalah kira-kira 3.7 bilion tahun. Kehidupan bermula di Bumi pada masa itu, dan persekitaran hidroterma dalam laut mungkin menjadi buaian. (Walaupun banyak bentuk kehidupan yang berbeza terus berkembang dalam persekitaran ini di Bumi hari ini, kita tidak dapat mencari bukti geologi langsung yang dipelihara dari masa hidup bermula kerana kerak aktif planet kita, kata ahli pasukan kajian.)

Persekitaran hidroterma dalam laut yang sama seperti yang terdapat di dunia lain – mungkin di bawah permukaan ais di Eropah bulan Jupiter dan bulan Saturnus Enceladus – boleh memfasilitasi evolusi kehidupan luar angkasa, menurut kenyataan itu.

Menggunakan data dari Spectrometer Imaging Reconnaissance Compact Reconnaissance untuk alat Mars, para penyelidik dapat mengenal pasti campuran mineral yang terkandung di dalam deposit, serta bentuk dan tekstur lapisan dasar tebal. Juga, pemerhatian menunjukkan bahawa aliran lava menguburkan beberapa deposit selepas lautan Eridania purba hilang, yang selanjutnya menyokong idea bahawa rantau ini aktif secara volkan.

Sebagai saintis terus mencari tanda-tanda kehidupan masa lalu di Marikh, kajian baru-baru ini menonjolkan satu lagi persekitaran basah yang mungkin pernah wujud di Marikh.

 Rajah ini menggambarkan tafsiran untuk asal-usul beberapa deposit di lembangan Eridania di selatan Mars kerana terhasil daripada aktiviti hidroterat laut lebih daripada 3 bilion tahun yang lalu

Rajah ini menggambarkan tafsiran untuk asal-usul beberapa deposit di lembangan Eridania di selatan Marikh akibat dari aktiviti hidroterat laut lebih daripada 3 bilion tahun yang lalu

             Kredit: NASA

"Deposit mendalam, hidrotermal dalam air di lembah Eridania mewakili kategori sasaran astrobiologi baru di Marikh," kata penyelidik dalam kenyataan itu. "Deposit perairan Eridania bukan hanya kepentingan untuk penerokaan Marikh, mereka mewakili tingkap ke Bumi awal."

Penemuan mereka diterbitkan dalam talian pada 10 Julai dalam jurnal Nature Communications.

Ikut Samantha Mathewson @ Sam_Ashley13. Ikut kami @Spacedotcom, Facebook dan Google+. Artikel asal di Space.com.

        

Mengundur Sains Buruk Tidak Membuatnya Hilang


Bayangkan anda seorang saintis . Anda menerbitkan kertas kerja dalam jurnal yang bereputasi beberapa tahun yang lalu, dan kertas itu telah memberi kesan dalam bidang pengajian anda. Ia telah membentuk penyelidikan anda sendiri dan telah memberi inspirasi kepada orang lain untuk mengejar penyelidikan serupa. Terima kasih kepada kertas itu, anda menikmati status tertentu di kalangan rakan-rakan anda. Sekarang anda mengetahui bahawa salah satu karya yang anda sebut dalam kertas itu baru ditarik balik. Sama ada ia adalah kesilapan yang jujur, fabrikasi keseluruhan, atau sesuatu yang ada di antara, kerja itu kini telah dibenderakan dan tidak lagi menjadi pengawasan saintifik.

Apa yang kamu lakukan?

PENDAPATAN WIRED

ABOUT

Jerome Samson adalah seorang sains data, media, dan perunding komunikasi penyelidikan. Beliau adalah ketua di 3.14 Kumpulan Pengurusan Penyelidikan sebuah agensi penyelidikan dan komunikasi, dan sebelumnya menguruskan editor penerbitan ilmiah di Nielsen.

usaha kumpulan. Ia perlahan, ia rumit, ia sering melibatkan pelbagai disiplin, dan ia hampir selalu mahal – semua sebab yang sangat baik untuk penyelidik untuk bersaing untuk berkongsi beban dan memeriksa persamaan masing-masing. Kertas 2015 di Surat Pemeriksaan Fizikal mempunyai rekod 5,154 pengarang bersama . Sudah tentu agak melampau, tetapi tidak ada persoalan yang merentasi banyak bidang hari ini, pengarang tunggal menyusut dan multi-pengarang berkembang .

Dan sains dibina di atas sains. Berdiri di bahu gergasi sebagai Google Cendekiawan membuat jelas pada halaman rumahnya. Penyelidik membaca sebelum kerja sebelum memulakan barisan pertanyaan mereka sendiri, sering mereplikasi eksperimen lepas untuk meletakkan asas untuk penyelidikan mereka sendiri. Mereka memetik rujukan dengan teliti, dan peer-review adalah norma sebelum sesuatu diterbitkan.

Para saintis membentuk masyarakat altruistik gergasi. Terdapat pertimbangan turf dan pembiayaan untuk bersaing, seperti dalam kehidupan seharian lain, tetapi secara besar-besaran, para saintis melakukan apa yang mereka lakukan kerana mereka termotivasi oleh kebaikan yang lebih baik, dan kerjasama dalam DNA mereka.

[OlehituapabilasebuahkertasditarikbalikyangberpotensimembahayakansegalasesuatuyangdatangselepasitumasyarakatsaintifikmasukkedalammodpembetulandiridanmenariksemuakertasituyangpadasatutitikatauyanglainsecaralangsungatautidaklangsungtelahmerujukkepadakerjaituBetulkan?Sehinggadiberitahukelak?Tidakbetul

Petikan langsung untuk kertas tunggal, sebelum dan selepas penarikan (untuk legenda, cerita ini).

Untuk satu perkara, perkataan bahawa kertas telah ditarik balik jarang membuat berita itu. Kecuali, sememangnya, kertas itu adalah sekeping malfeasance dan namanya adalah Andrew Wakefield . Pada kebanyakan masa, penerbit asal hanya menyiarkan nota penarikan balik, menampal tanda air "ditarik balik" pada versi dalam talian kertas itu, dan memberitahu pangkalan data dalam talian.

Sebagai contoh, penyenaraian PubMed bagi kertas sel stem yang digunakan dalam ilustrasi di atas mengandungi label "Artikel yang ditarik balik" yang besar di bahagian atasnya. Penyelidikan Kanser jurnal yang pertama menerbitkan karya pada tahun 2005, menyenaraikannya di bahagian atas: "Artikel ini mempunyai pembetulan, tetapi juga telah ditarik balik. " Ini semua bagus dan baik, tetapi untuk setiap kertas yang ditarik balik, salinan yang tidak ditanda asal masih hidup di dalam cetakan (di mana anda mungkin membacanya di tempat pertama). Dan jika anda telah menyebutkan kertas itu dalam karya anda sendiri, anda tidak menerima amaran bahawa salah satu kutipan anda baru saja dilemahkan.

Yang bermaksud bahawa anda mungkin benar-benar dalam kegelapan.

Bolehkah kerja anda sendiri bertahan tanpa satu petikan? Dalam kebanyakan kes, ia akan. Tetapi mengapa mengekalkan petikan itu apabila ia mungkin menimbulkan bayangan pada kerja anda? Dalam beberapa situasi di mana pencabulan itu menjalar asas-asas yang mana rumah anda dibina, anda akan mahu menangani keadaan keadaan, dan lebih cepat daripada kemudian.

sains sedang diserang. Pasukan cemerlang di Retraction Watch katalog sekitar 600 penarikan balik baru setiap tahun. Itu tidak semestinya sesuatu yang buruk – setelah semua, jumlah penarikan balik yang tinggi adalah tanda [[[Sakit] bahawa sains secara aktif membetulkannya sendiri. Dan apabila anda bandingkan angka itu kepada jumlah kertas saintifik di luar sana ( 2.5 juta kertas-kertas baru setiap tahun, yang diterbitkan oleh lebih daripada 35,000 jurnal di seluruh dunia), ia adalah peratusan yang sangat kecil. Tetapi yang baik separuh semua retractions adalah disebabkan oleh salah laku. Kepentingan politik sangat cepat menerkam dan menggunakan kes-kes tersebut untuk menyusun seluruh bidang pengajian. Dalam kitaran berita luar hari ini, membolehkan satu penarikan balik untuk memberi kesan riak ke atas kredibiliti penyelidikan masa depan hanya tidak boleh diterima

Jadi, apa yang kita lakukan mengenainya?

Darpa telah mengiktiraf masalah ini dan baru-baru ini menerbitkan permintaan [1945906] permintaan maklumat dengan penilaian suram berikut:

"Penerbitan hari ini kekurangan mekanisme untuk menggabungkan perubahan dinamik dengan cepat kesusasteraan, seperti penarikan balik, replikasi, atau penemuan baru, yang mungkin harus mengubah keyakinan pengguna dalam kesimpulan kajian tertentu. "

Agensi ini mengundang para penyelidik untuk membantu merancang beberapa sistem automatik Menetapkan tahap keyakinan terhadap hasil penyelidikan. Di samping p-nilai faktor impak h indeks dan altmetrics analisis, analisis rangkaian, dan pembelajaran mesin dengan pantas menilai kebolehpercayaan, kebolehulangan, dan keteguhan tuntutan penyelidikan.

Ini patut dipuji dan pasti dapat diterokai, tetapi sukar untuk membayangkan bahawa penyelesaian itu tidak melibatkan beberapa kerja keras berteknologi rendah yang serius: iaitu, memberi amaran kepada semua penulis yang telah memetik kerja yang ditarik balik secara langsung atau tidak langsung, dan meminta mereka menilai secara rasmi kesan penarikan balik itu pada kerja mereka sendiri. Kita boleh membahaskan bagaimana formal proses itu harus (haruskah semua kertas yang terkena ditahan sehingga mereka dibersihkan?), Tetapi ada sedikit keraguan yang perlu dilakukan.

Ini bukan perkara kecil . Ketika animasi di bahagian atas artikel itu menunjukkan, satu kertas sel stem yang diterbitkan pada tahun 2005 dan ditarik balik pada 2010 telah disebutkan 667 kali – setakat ini. Hampir separuh daripada penipuan tersebut berlaku selepas penarikan balik dibuat secara rasmi. Di sini kita, pada tahun 2017, tujuh tahun selepas penarikannya, dan penulis terus merujuknya seolah-olah tiada apa yang berlaku (termasuk setengah dozen kali dalam beberapa bulan terakhir sahaja). Tiada siapa yang mengetahui sejauh mana kesilapan dalam kertas itu telah menjejaskan mana-mana kertas itu di hilir.

Dan animasi di bahagian atas hanyalah akaun untuk petikan langsung. Setiap satu daripada 667 kertas itu, pada gilirannya, dinamakan oleh kertas lain, dan sebagainya dan sebagainya. Lihat bagaimana kesan riak dari penarikan balik itu berakhir dengan menjejaskan lebih daripada 33,000 karya:

Ilustrasi ini menunjukkan secara langsung (pertama -degree) dan notasi (darjah kedua sahaja) untuk kertas tunggal, sebelum dan selepas penarikan balik. Kesan riak dapat mencapai puluhan ribu kertas.

Sains adalah perkara yang kuat. Dan sebahagian daripada apa yang menjadikannya kuat adalah bagaimana saling berkaitan. Tetapi saling ketergantungan itu juga menjadikannya terdedah. Ia tidak perlu seperti itu. Dengan terus mengundurkan diri dan melompat pada peluang untuk menilai semula kerja mereka apabila sumber telah dicemari, para saintis akan menafikan sains saintifik tenaga yang mereka makan, dan pergi jauh untuk meningkatkan kedudukan penyelidikan mereka sendiri

]

Carta legenda: Untuk ilustrasi dalam artikel ini, setiap gumpalan mewakili kertas berasingan, dan saiz gumpalan itu adalah fungsi jumlah penerbitan kertas itu. Jarak gumpalan ke pusat mewakili tahun-tahun sejak penerbitan (2005 hingga 2017), dan warna sesuai dengan jurnal yang berlainan. Dalam ilustrasi kedua, garis-garis antara gumpalan selanjutnya mewakili hubungan antara kertas.

Pendapat WIRED menerbitkan potongan yang ditulis oleh penyumbang luar dan mewakili pelbagai daripada sudut pandangan. Baca lebih banyak pendapat sini .

Ahli arkeologi Adakah Hot di Trail Ini 16 Mystery Spectacular


Sekitar 3,200 tahun yang lalu, sekumpulan orang yang sarjana zaman moden sering menyebut Orang Laut menyerang bandar-bandar dan tamadun di seluruh Mediterranean timur. Banyak bandar-bandar telah musnah dan Orang Laut, yang mungkin berasal dari Aegean (berdasarkan reka bentuk tembikar mereka), menetap di Timur Tengah.

Penggalian bandar-bandar yang dikaitkan dengan Orang Laut dan kajian teks-teks purba yang menyebutnya sedang berjalan. Pada bulan Oktober 2017, ahli arkeologi mendedahkan sebuah batu tulis besar-besaran yang merujuk kepada Orang Laut dan ditemui di Beyköy, di Turki.

SpaceX Rocket melancarkan 10 satelit ke Orbit Isnin: Bagaimana Menonton Langsung


                     SpaceX Rocket melancarkan 10 satelit awal Isnin: Bagaimana Menonton Langsung

            
                                            

Sebuah roket SpaceX Falcon 9 berdiri di atas peluncuran syarikat itu di Pangkalan Udara Vandenberg di California menjelang misi Iridium-2 pada bulan Jun 2017. Roket Falcon 9 serupa akan melancarkan 10 satelit komunikasi Iridium Seterusnya ke orbit dari pad yang sama untuk misi Iridium-3 pada 9 Oktober 2017.

                     Kredit: SpaceX
                

            

Syarikat penerbangan angkasa lepas SpaceX dijadualkan melancarkan 10 satelit komunikasi ke orbit Bumi rendah awal Isnin (9 Okt), dan anda boleh menontonnya hidup dalam talian.

Roket SpaceX Falcon 9 dijangka meletup dari Pangkalan Tentera Udara Vandenberg di California pukul 8:37 pagi EDT (5:37 pagi PDT / 1237 GMT), membawa 10 satelit untuk Iridium Communications. Satu siaran web langsung dijangka bermula tidak lama sebelum pembukaan tetingkap pelancaran, dan anda boleh menontonnya di laman web SpaceX, atau di sini di Space.com.

Satelit adalah sebahagian daripada buruj Iridium Next, yang pada akhirnya akan terdiri daripada 66 satelit utama dan sembilan satelit sandaran on-orbit (serta enam sandaran yang akan kekal di atas tanah). Ini adalah yang ketiga daripada lapan pelancaran SpaceX yang dijadualkan untuk peluncuran Iridium Next, dan akan membawa jumlah satelit dalam orbit hingga 30.

Penggalak Falcon 9 yang boleh diguna semula yang akan digunakan dalam pelancaran esok akan membuat penerbangan pertamanya, wakil syarikat memberitahu Space.com. Ia menyelesaikan ujian statik pada hari Khamis (5 Oktober). SpaceX akan cuba mendarat penggalak tegak di kapal pengebom di Lautan Pasifik berikutan pelancaran supaya ia boleh digunakan pada misi masa depan. SpaceX berjaya mendaratkan roket peringkat pertama Falcon 9 sebanyak 16 kali dan menggantikan dua penyokong tahun ini.

 Sebuah ilustrasi satelit Iridium NEXT dalam orbit.

Sebuah ilustrasi satelit Iridium NEXT dalam orbit.

             Kredit: Iridium Communications

Iridium Communications yang diumumkan awal minggu ini telah mula menguji dan mengesahkan perkhidmatan Iridium Certus, yang akan menggunakan satelit Iridium Next untuk menyediakan "perkhidmatan jalur lebar sejagat yang benar-benar global" kepada penggunanya, menurut kenyataan dari syarikat itu. The 66 satelit akan tersebar di sekitar planet ini untuk menyediakan perkhidmatan kepada kawasan terpencil di dunia, kata syarikat itu.

"Iridium Certus akan mengubah keadaan status quo dalam sambungan satelit untuk penerbangan, maritim, mudah alih, Internet Perkara (IoT) dan pengguna kerajaan," kata Matt Desch, Ketua Pegawai Eksekutif Iridium, dalam kenyataan itu. "Mencapai kejayaan utama ini terus momentum kami untuk misi kami untuk memperkenalkan perkhidmatan dan aplikasi jalur lebar yang berubah-ubah yang direka untuk membantu rakan kongsi kami menyediakan penyelesaian sambungan yang kritikal, sama ada secara mandiri dan menyokong teknologi jalur lebar lain."

Perkhidmatan komersial dijangka tersedia dalam "suku kedua awal" pada 2018, menurut kenyataan itu.

                    
            

Pada Rabu (11 Oktober), satu lagi roket SpaceX Falcon 9 dijadualkan dilancarkan dari Kompleks Pelancaran NASA 39A di Pusat Angkasa Kennedy di Florida, yang membawa satelit komunikasi lain yang dikenali sebagai SES 11 / EchoStar 105.

Penggalak Falcon 9 untuk pelancaran itu, yang ditunda dari 7 Oktober, telah membuat satu spaceflight. Pada 19 Februari, penggalak membantu melancarkan kapal kargo Naga untuk menyampaikan bekalan NASA ke Stesen Angkasa Antarabangsa dan membuat pendaratan tepat pada kapal angkasa SpaceX.

Elon Musk menulis pada Instagram minggu ini bahawa syarikat itu juga akan cuba mendaratkan penggalak itu lagi.

Ikut Calla Cofield @ callacofield. Ikut kami @Spacedotcom, Facebook dan Google+. Artikel asal di Space.com.

        

Crack Teori Baru Membuka Kotak Hitam Rangkaian Neural Dalam


Walaupun mesin dikenali sebagai "rangkaian saraf yang mendalam" telah belajar untuk bercakap, memandu kereta, mengalahkan permainan video dan Go champions impian, gambar cat dan membantu membuat penemuan saintifik, mereka juga telah membingungkan pencipta manusia mereka, yang tidak pernah menjangkakan algoritma "pembelajaran yang mendalam" . Tidak ada asas asas yang membimbing reka bentuk sistem pembelajaran ini, selain inspirasi samar-samar yang diambil dari seni bina otak (dan tidak ada yang benar-benar memahami bagaimana itu beroperasi). [1945909]

Kisah asal dicetak semula dengan izin dari Quanta Magazine, sebuah penerbitan yang bebas dari editorial.


 pengarang foto "data-reactid =" 258 " Yayasan Simons yang misinya adalah untuk meningkatkan pemahaman orang ramai terhadap sains dengan meliputi perkembangan penyelidikan dan trend dalam bidang matematik dan sains fizikal dan kehidupan. </p>
</div></div>
</p></div>
<p data-reactid= Seperti otak, rangkaian saraf yang mendalam mempunyai lapisan neuron-buatan yang merupakan memori memori komputer. Apabila kebakaran neuron, ia menghantar isyarat kepada neuron yang berkaitan dalam lapisan di atas. Semasa pembelajaran yang mendalam, sambungan dalam rangkaian dikuatkan atau lemah sebagaimana diperlukan untuk menjadikan sistem lebih baik menghantar isyarat daripada data masukan-piksel gambar anjing, misalnya melalui lapisan-lapisan ke neuron yang berkaitan dengan tinggi- konsep tahap seperti "anjing." Selepas rangkaian neural yang mendalam telah "belajar" dari beribu-ribu gambar anjing sampel, ia dapat mengenal pasti anjing dalam foto baru dengan tepat seperti orang boleh. Lonjakan sihir dari kes-kes khas kepada konsep umum semasa pembelajaran memberikan rangkaian neural dalam kuasa mereka, sama seperti ia menonjolkan pemikiran manusia, kreativiti dan fakulti lain yang secara kolektif disebut "kecerdasan." Pakar-pakar tertanya-tanya apa itu tentang pembelajaran mendalam yang membolehkan pengumuman-dan sejauh mana otak memahami realiti dengan cara yang sama.

Lucy Reading-Ikkanda / Quanta Majalah

Bulan lalu, sebuah video YouTube mengenai satu ceramah persidangan di Berlin, yang dikongsi secara meluas di kalangan para penyelidik kecerdasan buatan, menawarkan jawapan yang mungkin. Dalam ceramah, Naftali Tishby seorang saintis komputer dan pakar neurologi dari Universiti Ibrani Yerusalem, membentangkan bukti menyokong teori baru yang menerangkan bagaimana pembelajaran mendalam berfungsi. Tishby berhujah bahawa rangkaian saraf yang mendalam belajar mengikut prosedur yang dipanggil "kesesakan maklumat," yang mana dia dan dua kolaborator mula-mula diterangkan dengan istilah teoritis semata-mata pada tahun 1999 . Idea ini ialah rangkaian data kemasukan bising yang berisik tentang butiran luaran seolah-olah dengan memerah maklumat melalui hambatan, hanya mengekalkan ciri-ciri yang paling relevan dengan konsep umum. [194906]

Tishby's penemuan mempunyai komuniti AI berdengung. "Saya percaya bahawa idea kesesakan maklumat boleh menjadi sangat penting dalam penyelidikan rangkaian neural yang akan datang," kata Alex Alemi Google Research, yang sudah membangunkan kaedah penghampiran baru analisis hambatan ke rangkaian neural yang besar. Kesesakan ini boleh berfungsi bukan sahaja sebagai alat teoritis untuk memahami mengapa rangkaian saraf kita berfungsi dan juga pada masa kini, tetapi juga sebagai alat untuk membina objektif dan arsitektur rangkaian baru, "kata Alemi.

Beberapa penyelidik tetap ragu-ragu bahawa teori ini menyumbang sepenuhnya kepada kejayaan pembelajaran mendalam, tetapi Kyle Cranmer ahli fizik zarah di New York University yang menggunakan pembelajaran mesin untuk menganalisis perlanggaran zarah di Hadron Besar Collider, mengatakan bahawa sebagai prinsip pembelajaran umum, ia "entah bagaimana berbau betul."

Geoffrey Hinton pelopor pembelajaran mendalam yang bekerja di Google dan University of Toronto, menghantar emel Tishby selepas menonton ceramahnya di Berlin. "Ia sangat menarik," tulis Hinton. "Saya perlu mendengarnya 10,000 kali untuk benar-benar memahaminya, tetapi sangat jarang sekali sekarang untuk mendengar ceramah dengan idea yang benar-benar asli di dalamnya yang mungkin menjadi jawapan kepada teka-teki yang sangat utama."

[MenurutTishbyyangmemandanghambatanmaklumatitusebagaiprinsipasasdibelakangpembelajaransamaadaandaalgoritmaseekorkudaseorangyangsadarataupengiraanfizikmengenaitingkahlakuyangmunculyangdijawablama"adalahyangpalingbanyakbahagianpentingdalampembelajaransebenarnyaadalahmelupakan"

The Bottleneck

Tishby mula merenung kesesakan maklumat pada masa yang penyelidik lain mula-mula memikirkan rangkaian neural yang mendalam, walaupun konsepnya belum dinamakan . Ia adalah tahun 1980-an, dan Tishby memikirkan bagaimana manusia yang baik berada di pengiktirafan ucapan-merupakan cabaran utama untuk AI pada masa itu. Tishby menyedari bahawa masalah utama adalah persoalan relevan: Apakah ciri-ciri yang paling relevan dalam kata-kata yang dituturkan, dan bagaimana kita menggoda ini daripada pembolehubah yang menemani mereka, seperti aksen, merendahkan dan intonasi? Secara umum, apabila kita menghadapi lautan data yang sebenarnya, isyarat mana yang kita simpan?

Naftali Tishby, seorang profesor sains komputer di Universiti Ibrani Yerusalem. [1945909]

Miriam Alster, Flash 90. ELSC Art dan Brain Week 2016

banyak kali dalam sejarah tetapi tidak pernah dirumus dengan betul, "kata Tishby dalam satu wawancara bulan lepas. "Selama bertahun-tahun orang berfikir teori maklumat bukanlah cara yang betul untuk memikirkan tentang relevan, bermula dengan salah faham yang pergi ke Shannon sendiri."

Claude Shannon, pengasas teori maklumat, dalam erti kata membebaskan kajian maklumat bermula pada tahun 1940-an dengan membenarkan ia dipertimbangkan dalam abstrak-sebagai 1s dan 0s dengan makna matematik murni. Shannon mengambil pandangan bahawa, seperti yang dijelaskan oleh Tishby, "maklumat bukan mengenai semantik." Tetapi, Tishby berhujah, ini tidak benar. Menggunakan teori maklumat, dia menyadari, "anda boleh menentukan 'relevan' dalam erti kata yang tepat."

Bayangkan X adalah set data yang rumit, seperti piksel gambar anjing, dan Y adalah lebih mudah pembolehubah yang diwakili oleh data tersebut, seperti perkataan "anjing." Anda boleh menangkap semua maklumat "relevan" dalam X tentang Y dengan memampatkan X sebanyak yang anda boleh tanpa kehilangan keupayaan meramalkan Y. Dalam kertas tahun 1999 mereka, Tishby dan co -authors Fernando Pereira sekarang di Google, dan William Bialek kini di Princeton University, menggubal ini sebagai masalah pengoptimuman matematik. Ia adalah idea asas tanpa permohonan pembunuh.

"Saya telah berfikir sepanjang garis ini dalam pelbagai konteks selama 30 tahun," kata Tishby. "Kebahagiaan saya ialah rangkaian saraf yang mendalam menjadi sangat penting."

Eyeballs on Faces on People on Scenes

Walaupun konsep di sebalik rangkaian neural telah ditendang selama beberapa dekad, prestasi mereka dalam tugas seperti ucapan dan pengiktirafan imej hanya bermula pada awal tahun 2010, disebabkan oleh rejimen latihan yang lebih baik dan pemproses komputer yang lebih kuat. Tishby mengiktiraf hubungan mereka yang berpotensi kepada prinsip hambatan maklumat pada tahun 2014 selepas membaca kertas yang mengejutkan oleh ahli fizik David Schwab dan Pankaj Mehta

Kedua-duanya menemui bahawa algoritma pengajaran mendalam yang dicipta oleh Hinton menggelar kerja-kerja "bersih kepercayaan yang mendalam", dalam kes tertentu, sama seperti renormalisasi, teknik yang digunakan dalam fizik untuk mengezum pada sistem fizikal dengan kasar-butiran mengenai butirannya dan mengira keseluruhan keadaannya. Apabila Schwab dan Mehta menerapkan kepercayaan mendalam kepada model magnet di "titik kritikal", di mana sistem itu fraktal, atau sama pada setiap skala, mereka mendapati bahawa rangkaian secara automatik menggunakan prosedur seperti renormalization untuk mengetahui keadaan model. Ia merupakan petunjuk yang mengagumkan bahawa, sebagai biophysicist Ilya Nemenman berkata pada masa itu, "mengekstrak ciri-ciri relevan dalam konteks fizik statistik dan mengekstrak ciri-ciri yang relevan dalam konteks pembelajaran mendalam bukan hanya kata-kata yang serupa, adalah satu dan yang sama. "

Satu-satunya masalah ialah, secara umum, dunia sebenar tidak fraktal. "Dunia semula jadi tidak telinga di telinga pada telinga di telinga; ia adalah bola mata pada wajah pada orang di layar, "kata Cranmer. "Jadi saya tidak katakan [the renormalization procedure] adalah mengapa pembelajaran mendalam pada imej semula jadi berfungsi dengan baik." Tetapi Tishby, yang pada masa itu sedang menjalani kemoterapi untuk kanser pankreas, menyedari bahawa kedua-dua pembelajaran mendalam dan prosedur kasar dapat dilakukan diliputi oleh idea yang lebih luas. "Berfikir tentang sains dan peranan idea lama saya adalah bahagian penting dalam penyembuhan dan pemulihan saya," katanya.

Noga Zaslavsky, kiri, dan Ravid Shwartz- Ziv membantu mengembangkan teori kesesakan maklumat pembelajaran mendalam sebagai pelajar siswazah dari Naftali Tishby.

Noga Zaslavsky / Ravid Shwartz-Ziv

[19459019

Pada tahun 2015, beliau dan pelajarnya, Noga Zaslavsky hipotesis bahawa pembelajaran mendalam merupakan prosedur kesesakan maklumat yang memampatkan data bising sebanyak mungkin sambil memelihara maklumat tentang apa yang diwakili oleh data. Eksperimen baru Tishby dan Shwartz-Ziv dengan rangkaian saraf yang mendalam menunjukkan bagaimana prosedur kesesakan itu sebenarnya bermain. Dalam satu kes, penyelidik menggunakan rangkaian kecil yang boleh dilatih untuk menandakan data input dengan 1 atau 0 (berfikir "anjing" atau "tidak anjing") dan memberikan 282 sambungan neural mereka kekuatan awal rawak. Mereka kemudian mengesan apa yang berlaku kerana rangkaian yang terlibat dalam pembelajaran mendalam dengan 3,000 sampel data input sampel.

Algoritma asas yang digunakan dalam majoriti prosedur pembelajaran mendalam untuk tweak sambungan saraf sebagai respons terhadap data dipanggil "Keturunan kecerunan stokastik": Setiap kali data latihan disalurkan ke dalam rangkaian, satu larian aktiviti penembakan menyapu ke atas melalui lapisan-lapisan neuron buatan. Apabila isyarat mencapai lapisan atas, corak penembakan akhir dapat dibandingkan dengan label yang betul untuk imej-1 atau 0, "anjing" atau "tidak ada anjing". Sebarang perbezaan antara pola menembak ini dan corak yang betul adalah "back- disebarkan "di bawah lapisan, yang bermaksud, seperti seorang guru membetulkan peperiksaan, algoritma menguatkan atau melemahkan setiap sambungan untuk menjadikan lapisan rangkaian lebih baik untuk menghasilkan isyarat output yang betul. Sepanjang latihan, corak umum dalam data latihan menjadi tercermin dalam kekuatan sambungan, dan rangkaian menjadi pakar dengan label data dengan betul, seperti dengan mengenali anjing, perkataan, atau 1.

[DalameksperimenmerekaTishbydanShwartz-ZivmengesanberapabanyakmaklumatsetiaplapisanrangkaiansarafdalamdikekalkanmengenaidatainputdanberapabanyakmaklumatyangdipertahankansetiapsatumengenailabelkeluaranParasaintismendapatibahawalapisandemilapisanrangkaianyangbersatudenganhambatanmaklumatyangdihadkanolehteori:batasanteoretisyangdiperolehidalamkertasasalTishbyPereiradanBialekyangmewakilisistemmutlakyangterbaikyangbolehdilakukanuntukmengekstrakmaklumatyangrelevanPadamasayangsamarangkaiantelahmenekankaninputseberapabanyakyangmungkintanpamengorbankankeupayaanuntukmeramalkantepatlabelnya

Tishby dan Shwartz-Ziv juga membuat penemuan yang menarik bahawa pembelajaran mendalam diteruskan dalam dua fasa: pendek Fasa "fitting", di mana rangkaian belajar untuk melabelkan data latihannya, dan fasa "mampatan" yang lebih lama, di mana ia menjadi baik pada generalisasi, seperti yang diukur oleh prestasinya dalam pelabelan data ujian baru.

Sebagai rangkaian neural mendalam tweak hubungannya dengan keturunan kecerunan stokastik, pada mulanya bilangan bit yang menyimpannya mengenai data masukan tetap kira-kira tetap atau meningkat sedikit, sebagai sambungan menyesuaikan untuk mengekod pola pada input dan rangkaian mendapat baik pada label yang sesuai ia. Sesetengah pakar telah membandingkan fasa ini untuk menghafal.

Kemudian pembelajaran beralih ke fasa pemampatan. Rangkaian mula menumpahkan maklumat mengenai data input, mengesan hanya ciri terkuat-korelasi yang paling relevan dengan label output. Ini berlaku kerana, dalam setiap lelaran kecerunan stokastik stokastik, korelasi yang tidak disengajakan dalam data latihan memberitahu jaringan untuk melakukan perkara yang berbeza, mendailkan kekuatan sambungan sarafnya ke atas dan ke bawah dalam jalan rawak . Rawak ini berkesan sama seperti memampatkan perwakilan sistem data input. Sebagai contoh, beberapa gambar anjing mungkin mempunyai rumah di latar belakang, sementara yang lain tidak. Sebagai kitaran rangkaian melalui gambar-gambar latihan ini, ia mungkin "lupa" hubungan antara rumah dan anjing dalam sesetengah foto kerana foto-foto lain menentangnya. Ini melupakan spesifikasi, Tishby dan Shwartz-Ziv berhujah, yang membolehkan sistem membentuk konsep umum. Sesungguhnya eksperimen mereka mendedahkan bahawa rangkaian saraf yang mendalam meningkatkan prestasi generalisasi mereka semasa fasa mampatan, menjadi lebih baik pada data ujian label. (Rangkaian neural yang terlatih yang terlatih untuk mengenali anjing dalam foto mungkin diuji pada foto baru yang mungkin atau tidak termasuk anjing.)

Ia masih dapat dilihat sama ada maklumat hambatan mengawal semua rejim pembelajaran yang mendalam, atau sama ada terdapat laluan lain untuk generalisasi selain pemampatan. Sesetengah pakar AI melihat idea Tishby sebagai salah satu daripada banyak pandangan teoritis penting mengenai pembelajaran mendalam yang telah muncul baru-baru ini. Andrew Saxe seorang penyelidik AI dan pakar neurosik teori di Harvard University, menyatakan bahawa sesetengah rangkaian saraf yang sangat besar tidak sepatutnya memerlukan fasa mampatan yang dikeluarkan untuk tujuan umum. Sebaliknya, program penyelidik dalam sesuatu yang disebut awal berhenti, yang memotong latihan pendek untuk mencegah rangkaian dari penyandian terlalu banyak korelasi di tempat pertama.

Tishby berpendapat bahawa model rangkaian dianalisis oleh Saxe dan rakannya berbeza dari arsitektur rangkaian neural yang dalam, tetapi bagaimanapun, kesimpulan data yang dihadapi teori mendefinisikan prestasi generalisasi rangkaian ini lebih baik daripada kaedah lain. Soalan mengenai sama ada kesesakan yang berlaku untuk rangkaian neural yang lebih besar sebahagiannya ditangani oleh ujikaji terbaru Tishby dan Shwartz-Ziv, tidak termasuk dalam kertas awal mereka, di mana mereka melatih rangkaian saraf yang jauh lebih besar, 330,000-sambungan untuk mengenali digit tulisan tangan dalam pangkalan data Institut Standard dan Teknologi Kebangsaan yang diubah suai oleh 60,000-imej satu penanda aras yang terkenal untuk mengukur prestasi algoritma dalam pembelajaran. Para saintis menyaksikan penumpuan rangkaian yang sama ke dalam kesesakan maklumat yang dihadapi oleh teori; mereka juga memerhatikan dua fasa pembelajaran yang mendalam, dipisahkan oleh peralihan yang lebih tajam berbanding dengan rangkaian yang lebih kecil. "Saya yakin sepenuhnya bahawa ini adalah fenomena umum," kata Tishby.

Manusia dan Mesin

Misteri bagaimana otak menyaring isyarat dari deria kami dan menaikkan mereka ke tahap kesedaran yang sedar kami mendorong banyak minat awal dalam rangkaian saraf yang mendalam di kalangan perintis AI, yang berharap dapat mentakrifkan peraturan pembelajaran otak. Pengamal AI sejak dahulu telah meninggalkan jalan yang gila untuk kemajuan teknologi, sebaliknya menampar lonceng dan wisel yang menaikkan prestasi dengan tidak menganggap kebetulan biologi. Namun, kerana mesin pemikiran mereka mencapai kejayaan yang lebih besar-bahkan menimbulkan ketakutan bahawa AI dapat suatu hari nanti menimbulkan ancaman eksistensial – banyak penyelidik berharap penerokaan ini akan mendedahkan pandangan umum mengenai pembelajaran dan kecerdasan.

Bahagian pembelajaran yang paling penting sebenarnya dilupakan.
Naftali Tishby

Tasik Brenden seorang penolong profesor psikologi dan sains data di New York University yang mengkaji persamaan dan perbezaan bagaimana manusia dan mesin belajar mengatakan bahawa penemuan Tishby mewakili " satu langkah penting untuk membuka kotak hitam rangkaian neural, "tetapi beliau menegaskan bahawa otak mewakili kotak hitam yang lebih besar, hitam. Otak dewasa kita, yang mempunyai beberapa ratus trillion sambungan di antara 86 bilion neuron, kemungkinan besar menggunakan beg trik untuk meningkatkan generalisasi, melampaui prosedur pembelajaran imej-dan pengimejan asas yang berlaku semasa bayi dan mungkin dalam banyak hal menyerupai Sebagai contoh, Lake berkata fase pasang dan mampatan yang Tishby dikenal pasti tidak mempunyai analog dalam cara kanak-kanak belajar watak-watak tulisan tangan, yang dia belajar. Kanak-kanak tidak perlu melihat beribu-ribu contoh watak dan memampatkan perwakilan mental mereka dalam tempoh masa yang panjang sebelum mereka dapat mengenali contoh-contoh lain surat itu dan menulis sendiri. Malah, mereka boleh belajar dari satu contoh. Lake dan model rakan sekerjanya mencadangkan otak boleh membongkarkan surat baru itu ke dalam satu siri pukulan-konstruk mental yang sedia ada sebelum ini – membolehkan konsepsi itu ditujukan kepada bangunan pengetahuan terdahulu. "Daripada memikirkan imej huruf sebagai corak piksel dan mempelajari konsep sebagai pemetaan ciri-ciri" seperti dalam algoritma mesin pembelajaran standard, Lake menjelaskan, "sebaliknya saya bertujuan membina model penyebab mudah huruf itu," jalan yang lebih pendek kepada generalisasi.

Idea-idea bijak seperti ini mungkin memegang pengajaran untuk komuniti AI, seterusnya mengarahkan kedua-dua bidang. Tishby percaya teori bottlenecknya akhirnya akan membuktikan berguna dalam kedua-dua disiplin, walaupun ia memerlukan bentuk yang lebih umum dalam pembelajaran manusia daripada AI. Satu pandangan segera yang dapat diperoleh dari teori adalah pemahaman yang lebih baik tentang jenis masalah yang dapat diselesaikan oleh rangkaian saraf yang nyata dan buatan. "Ia memberi gambaran lengkap mengenai masalah yang boleh dipelajari," kata Tishby. Ini adalah "masalah di mana saya boleh menghapus bunyi dalam input tanpa menyakiti keupayaan saya untuk mengklasifikasikan. Ini adalah masalah penglihatan semula jadi, pengecaman pertuturan. Ini juga merupakan masalah yang dapat diatasi oleh otak kita. "

Sementara itu, kedua-dua rangkaian neural yang sebenar dan tiruan tersandung pada masalah di mana setiap perkara penting dan perbezaan minit dapat membuang hasil keseluruhan. Kebanyakan orang tidak boleh dengan cepat membiak dua nombor besar di kepala mereka, contohnya. "Kami mempunyai masalah lama seperti ini, masalah logik yang sangat sensitif kepada perubahan dalam satu pembolehubah," kata Tishby. "Pengelasan, masalah diskret, masalah kriptografi. Saya tidak fikir pembelajaran yang mendalam akan membantu saya memecahkan kod-kod cryptographic. "

Mengasingkan kedalaman maklumat, mungkin-bermakna meninggalkan beberapa butiran di belakang. Ini tidak begitu baik untuk melakukan algebra dengan cepat, tetapi itu bukan perniagaan utama otak. Kami mencari muka yang biasa di kalangan orang ramai, memerintahkan kekacauan, isyarat-isyarat penting di dunia yang bising.

Kisah asal dicetak semula dengan kebenaran dari Quanta Magazine penerbitan bebas secara rasmi dari Yayasan Simons yang misinya adalah untuk meningkatkan pemahaman orang ramai terhadap sains dengan meliputi perkembangan penyelidikan dan trend dalam matematik dan sains fizikal dan kehidupan.

Prasasti Batu Lama 3,200-Tahun Beritahu Trojan Prince, Sea People


            

Sebuah kepingan batu berusia 3,200 tahun dengan sebuah prasasti yang menceritakan putera Trojan dan mungkin merujuk kepada Orang Laut misterius yang telah diuraikan, ahli arkeologi mengumumkan hari ini (7 Oktober).

Prasasti batu, yang panjangnya 95 kaki (29 meter), menggambarkan kebangkitan kerajaan yang bernama Mira, yang melancarkan kempen ketenteraan yang dipimpin oleh putera bernama Muksus dari Troy.

Prasasti ini ditulis dalam bahasa kuno bernama Luwian yang hanya beberapa sarjana, tidak lebih dari 20 oleh beberapa perkiraan, boleh dibaca hari ini. Para ulama termasuk Fred Woudhuizen, seorang sarjana bebas, yang kini telah menguraikan satu salinan tulisan itu. [Cracking Codices: 10 of the Most Mysterious Ancient Manuscripts]

Woudhuizen dan Eberhard Zangger, seorang ahli geologi geologi yang presiden Yayasan Pengajian Luwian, akan menerbitkan penemuan pada prasasti pada edisi Desember jurnal Proceedings of the Dutch Archeological and Historical Society.

 Menurut nota James Mellaart, prasasti Luwian ini disalin oleh arkeologi Georges Perrot pada tahun 1878 di Beyköy di Turki. Prasasti ini bermula pada 3,200 tahun dan membincangkan kebangkitan kerajaan yang dipanggil Mira dan bagaimana ia melancarkan serangan ke sasaran di seluruh Timur Tengah, memusnahkan Empayar Hittite, bersama dengan kerajaan-kerajaan lain

Menurut nota James Mellaart, prasasti Luwian ini disalin oleh ahli arkeologi Georges Perrot pada tahun 1878 di Beyköy di Turki. Prasasti ini bermula 3,200 tahun dan membincangkan kebangkitan kerajaan yang dipanggil Mira dan bagaimana ia melancarkan serangan ke sasaran di seluruh Timur Tengah, memusnahkan Empayar Hittite, bersama dengan kerajaan-kerajaan lain

             Kredit: James Mellaart

Sekiranya prasasti ini sahih, ia bersinar pada masa ketika persekutuan orang-orang yang ulama moden kadang-kadang memanggil Orang-orang Laut memusnahkan bandar-bandar dan peradaban di seluruh Timur Tengah, kata para ulama. Kerajaan Mira, yang terlibat dalam kempen ketenteraan ini, nampaknya merupakan bagian dari konfederasi Orang Laut ini yang memberikan penyertaan mereka dalam serangan itu.

Prasasti itu menceritakan bagaimana Raja Kupantakuruntas memerintah sebuah kerajaan bernama Mira yang terletak di wilayah Turki barat sekarang. Mira menguasai Troy (juga di Turki), menurut prasasti itu, yang juga menggambarkan putera Trojan Muksus yang mengetuai ekspedisi laut yang berjaya menaklukkan Ashkelon, yang terletak di Israel zaman sekarang, dan membina sebuah kubu di sana. [Biblical Battles: 12 Ancient Wars Lifted from the Bible]

Perincian inskripsi Raja Kupantakuruntas 'laluan bertingkat ke takhta Mira: Bapanya, Raja Mashuittas, menguasai Troy selepas seorang raja Trojan bernama Walmus telah digulingkan. Tidak lama selepas itu, Raja Mashuittas mengembalikan Walmus ke atas tahta Trojan sebagai pertukaran untuk kesetiaannya kepada Mira, kata prasasti itu.

Kupantakuruntas menjadi raja Mira setelah ayahnya meninggal dunia. Dia kemudian menguasai Troy, walaupun dia bukan raja sebenar Troy. Dalam tulisan itu, Kupantakuruntas menggambarkan dirinya sebagai penjaga Troy, memohon penguasa masa depan Troy untuk "menjaga Wilusa [an ancient name for Troy] (seperti) raja besar (mira)." (terjemahan oleh Woudhuizen)

Prasasti itu sendiri tidak lagi wujud, setelah dimusnahkan pada abad ke-19, tetapi rekod-rekod prasasti itu, termasuk salinannya, ditemui di ladang James Mellaart, ahli arkeologi terkenal yang meninggal dunia pada tahun 2012. Mellaart menemui beberapa tapak kuno di hidupnya, yang paling terkenal adalah Çatalhöyük, penyelesaian 9,500 tahun yang besar di Turki yang dikhususkan oleh beberapa ulama sebagai kota tertua di dunia. [The 25 Most Mysterious Archaeological Finds on Earth]

Mellaart meninggalkan arahan yang mengatakan bahawa jika tulisan itu tidak dapat dipecahkan sepenuhnya dan diterbitkan sebelum dia meninggal, ulama lain harus melakukannya secepat mungkin. Sesetengah sarjana (bukan pasukan Zangger dan Woudhuizen) telah membangkitkan kebimbangan bahawa prasasti ini boleh menjadi pemalsuan moden yang dicipta oleh Mellaart atau orang lain.

Mellaart secara ringkas menyebutkan kewujudan prasasti itu dalam sekurang-kurangnya satu penerbitan, kajian buku yang diterbitkan pada tahun 1992 dalam Buletin jurnal Persatuan Arkeologi Anglo-Israel. Tetapi dia tidak pernah menerangkan sepenuhnya prasasti itu dalam penerbitan ilmiah.

Menurut nota Mellaart, prasasti itu disalin pada tahun 1878 oleh ahli arkeologi bernama Georges Perrot dekat sebuah kampung yang dipanggil Beyköy di Turki. Tidak lama selepas Perrot merekodkan tulisan itu, penduduk kampung menggunakan batu sebagai bahan binaan untuk masjid, menurut nota Mellaart. Selepas tulisan itu digunakan sebagai bahan binaan untuk masjid, pihak berkuasa Turki mencari kampung itu dan mendapati tiga tablet gangsa yang tercatat yang kini hilang. Tablet gangsa tidak pernah diterbitkan dan tidak pasti apa yang mereka katakan.

Seorang ulama yang bernama Bahadır Alkım (yang meninggal dunia pada tahun 1981) telah menemui semula lukisan Prrot dan membuat satu salinan, yang mana Mellaart juga disalin dan yang kini telah diuraikan oleh pasukan Swiss-Belanda.

Mellaart adalah sebahagian daripada kumpulan sarjana yang, sejak tahun 1956, bekerja untuk menguraikan dan menerbitkan salinan Prasasti Perrot, bersama-sama dengan tablet gangsa yang sudah hilang dan beberapa prasasti Luwian yang lain, nota beliau mengatakan.

Nota-nota Mellaart menyatakan bahawa pasukan yang dia adalah sebahagian daripada tidak dapat menerbitkan karya sebelum kebanyakan ahli pasukan meninggal dunia. Nota-nota menambah bahawa pasukan Mellaart bekerja bersama termasuk cendekiawan Albrecht Goetze (meninggal tahun 1971), Bahadır Alkım (meninggal 1981), Handam Alkım (meninggal tahun 1985), Edmund Irwin Gordon (meninggal tahun 1984), Richard David Barnett (meninggal tahun 1986) Zübeyir Koşay (meninggal 1984). Mellaart, yang merupakan salah seorang anggota pasukan yang lebih muda, meninggal dunia pada usia 86 tahun, setelah menjalani hidup lebih lama daripada pasukannya

Pasukan Swiss-Belanda mendapati bahawa pada tahun-tahun kemudiannya, Mellaart menghabiskan banyak masa untuk memahami salinan-salinan prasasti Luwian yang berlainan dalam miliknya. Walau bagaimanapun, Mellaart tidak dapat membaca Luwian; dia dibawa ke pasukan untuk pengetahuannya mengenai landskap arkeologi Turki barat, sementara ahli lain dapat membaca bahasa kuno. [Cracking Codes: 5 Ancient Languages Yet to Be Deciphered]

Sains Live bercakap kepada beberapa ulama yang tidak bergabung dengan penyelidikan. Sebahagian daripada mereka menyatakan kebimbangan bahawa prasasti itu adalah pemalsuan zaman moden. Mereka berkata sehingga rekod-rekod prasasti itu ditemui yang tidak ditinggalkan oleh Mellaart, mereka tidak dapat memastikan prasasti tersebut wujud.

Zangger dan Woudhuizen mengatakan bahawa akan sangat sukar, jika tidak mustahil, untuk Mellaart atau orang lain untuk membuat pemalsuan seperti itu. Prasasti ini sangat panjang, dan Mellaart tidak dapat membaca, apalagi menulis Luwian, kata mereka dalam kertas mereka. Mereka juga menyatakan bahawa tiada siapa yang telah menguraikan Luwian sehingga tahun 1950-an, yang bermaksud bahawa Perrot tidak akan dapat menjalinnya sama ada. Zangger dan Woudhuizen menambah bahawa beberapa ulama sekarang dapat membaca Luwian, lebih kurang menuliskan tulisan lama. Mereka berkata mereka juga tidak faham mengapa Mellaart ingin mencipta pemalsuan yang panjang dan kompleks, tetapi meninggalkan sebahagian besarnya tidak diterbitkan. [24 Amazing Archaeological Discoveries]

Mellaart dituduh dalam hidupnya secara tidak sengaja membantu penyeludup dan membesar-besarkan atau bahkan "membayangkan bukti" (seperti Ian Hodder, pengarah penggalian semasa di Çatalhöyük meletakkannya) untuk membuktikan idea-idea arkeologinya; Walau bagaimanapun, dia tidak pernah didapati melakukan pemalsuan, kata Zangger dan Woudhuizen.

Walau bagaimanapun, Zangger memberitahu Live Science bahawa sehingga rekod-rekod prasasti itu ditemui selain harta pusaka Mellaart, dia tidak boleh benar-benar yakin ia adalah sahih dan tidak pemalsuan.

Zangger juga menerbitkan butiran mengenai prasasti yang baru diuraikan dalam buku bahasa Jerman yang bernama "Die Luwier und der Trojanische Krieg – Eine Forschungsgeschichte," (Orell Füssli, 2017), yang dikeluarkan hari ini.

Catatan editor: Artikel ini dikemaskini untuk mencerminkan fakta bahwa Woudhuizen, bukan Zangger, dapat membaca Luwian dan adalah orang yang menguraikan tulisan tersebut

Artikel aslinya diterbitkan pada Sains Hidup.